Loading...
Statistics
Advertisement

STL Kids Music Thea
www.stlbirthdayparty.com/
RockShow Academy - Find Info regarding STL Music Lessons, STL KIds Parties, Rock Bands, Recording Studio. Upcoming Events as well as Media and Resources.

Stlbirthdayparty.com

Domain is redirected to: Rockshowacademy.com
Advertisement
Stlbirthdayparty.com is hosted in United States / Ashburn . Stlbirthdayparty.com doesn't use HTTPS protocol. Number of used technologies: 6. First technologies: CSS, Html, Html5, Number of used javascripts: 2. First javascripts: Require.min.js, Main-r.min.js, Number of used analytics tools: 0. Its server type is: Microsoft-IIS/7.5. Its CMS is: Wix.

Technologies in use by Stlbirthdayparty.com

Technology

Number of occurences: 6
  • CSS
  • Html
  • Html5
  • Javascript
  • Php
  • SVG

Advertisement

Javascripts

Number of occurences: 2
  • require.min.js
  • main-r.min.js

Content Management System

Number of occurences: 1
  • Wix

Server Type

  • Microsoft-IIS/7.5

Powered by

  • ASP.NET

Conversion rate optimization

visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Stlbirthdayparty.com

Missing HTTPS protocol.

    Meta - Stlbirthdayparty.com

    Number of occurences: 7
    • Name:
      Content: RockShow Academy - Find Info regarding STL Music Lessons, STL KIds Parties, Rock Bands, Recording Studio. Upcoming Events as well as Media and Resources.
    • Name: fb_admins_meta_tag
      Content: 170268033026512
    • Name: keywords
      Content: STL music lessons, St. Louis music lessons, bass guitar lessons, drum lessons, guitar lessons, keyboard lessons, kids acting class, kids acting school, piano lessons, rock band class, rock band school, st louis kids theater, stl kids theater
    • Name: description
      Content: RockShow Academy - Find Info regarding STL Music Lessons, STL KIds Parties, Rock Bands, Recording Studio. Upcoming Events as well as Media and Resources.
    • Name: SKYPE_TOOLBAR
      Content: SKYPE_TOOLBAR_PARSER_COMPATIBLE
    • Name: viewport
      Content: minimum-scale=0.25, maximum-scale=1.2
    • Name: fragment
      Content: !

    Server / Hosting

    • IP: 52.71.197.186
    • Latitude: 39.05
    • Longitude: -77.47
    • Country: United States
    • City: Ashburn

    Rname

    • ns17.domaincontrol.com
    • ns18.domaincontrol.com
    • smtp.secureserver.net
    • mailstore1.secureserver.net

    Target

    • dns.jomax.net

    HTTP Header Response

    HTTP/1.1 301 Moved Permanently Cache-Control: max-age=900 Content-Length: 0 Content-Type: text/html Location: http://www.rockshowacademy.com/kids-parties#!party/c10tw Server: Microsoft-IIS/7.5 X-AspNet-Version: 4.0.30319 X-Powered-By: ASP.NET Date: Mon, 04 Jul 2016 05:43:20 GMT Age: 0 X-Cache: MISS from s_mf15 X-Cache-Lookup: MISS from s_mf15:80 Via: 1.1 s_mf15 (squid/3.5.6) Connection: keep-alive HTTP/1.1 200 OK Cache-Control: max-age=0, must-revalidate Content-Language: en Content-Length: 49152 Content-Type: text/html;charset=UTF-8 Date: Mon, 04 Jul 2016 05:43:21 GMT ETag: eb5394469c1b16c11311b535b9ba37f0 Expires: Thu, 01 Jan 1970 00:00:00 GMT Pragma: no-cache Server: Pepyaka/1.9.13 Set-Cookie: _wixAB3=16151#2;Path=/;Domain=.wix.com;Expires=Mon, 02-Jan-2017 05:43:21 GMT Vary: User-Agent X-Seen-By: 2Ll7DGndYHl7xZA4UHeE1qzhGl4kqOrRB2lgJXJWOaEVg8yBNrCddpK11/FwIFN7,+kLaVtGK59SkbKvDOz3O1vKjiM3HhjsT5sK9PwlANII=,LwsIp90Tma5sliyMxJYVEqNpclg1M0eTqofe+LHLWqPnaXGSE7xQP0F5eUkr7UI2,Tw2AanFDQ+Wwo8Xxk6ZL7rHKeAJXtkPxqn+uc4aMlOC+jMCXd9XU1JrWr1jeKC+NnUoPRWylvzmW1WtoYIgS/A== X-Wix-Renderer-Server: app202.vac.aws X-Wix-Request-Id: 1467611000.992634673995689799 X-Cache: MISS from s_mf15 X-Cache-Lookup: MISS from s_mf15:80 Via: 1.1 s_mf15 (squid/3.5.6) Connection: keep-alive

    DNS

    host: stlbirthdayparty.com
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 184.168.221.13
    host: stlbirthdayparty.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns17.domaincontrol.com
    host: stlbirthdayparty.com
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: ns18.domaincontrol.com
    host: stlbirthdayparty.com
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: ns17.domaincontrol.com
    5. rname: dns.jomax.net
    6. serial: 2016050300
    7. refresh: 28800
    8. retry: 7200
    9. expire: 604800
    10. minimum-ttl: 3600
    host: stlbirthdayparty.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 0
    5. target: smtp.secureserver.net
    host: stlbirthdayparty.com
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: mailstore1.secureserver.net

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.tlbirthdayparty.com, www.setlbirthdayparty.com, www.etlbirthdayparty.com, www.swtlbirthdayparty.com, www.wtlbirthdayparty.com, www.sdtlbirthdayparty.com, www.dtlbirthdayparty.com, www.sxtlbirthdayparty.com, www.xtlbirthdayparty.com, www.sftlbirthdayparty.com, www.ftlbirthdayparty.com, www.sgtlbirthdayparty.com, www.gtlbirthdayparty.com, www.sttlbirthdayparty.com, www.ttlbirthdayparty.com, www.slbirthdayparty.com, www.stqlbirthdayparty.com, www.sqlbirthdayparty.com, www.stalbirthdayparty.com, www.salbirthdayparty.com, www.st lbirthdayparty.com, www.s lbirthdayparty.com, www.stwlbirthdayparty.com, www.swlbirthdayparty.com, www.stelbirthdayparty.com, www.selbirthdayparty.com, www.stzlbirthdayparty.com, www.szlbirthdayparty.com, www.stxlbirthdayparty.com, www.sxlbirthdayparty.com, www.stclbirthdayparty.com, www.sclbirthdayparty.com, www.stbirthdayparty.com, www.stlubirthdayparty.com, www.stubirthdayparty.com, www.stl8birthdayparty.com, www.st8birthdayparty.com, www.stl9birthdayparty.com, www.st9birthdayparty.com, www.stljbirthdayparty.com, www.stjbirthdayparty.com, www.stl0birthdayparty.com, www.st0birthdayparty.com, www.stlmbirthdayparty.com, www.stmbirthdayparty.com, www.stlpbirthdayparty.com, www.stpbirthdayparty.com, www.stlobirthdayparty.com, www.stobirthdayparty.com, www.stlirthdayparty.com, www.stlbqirthdayparty.com, www.stlqirthdayparty.com, www.stlbwirthdayparty.com, www.stlwirthdayparty.com, www.stlbzirthdayparty.com, www.stlzirthdayparty.com, www.stlbxirthdayparty.com, www.stlxirthdayparty.com, www.stlbirthdayparty.com, www.stlirthdayparty.com, www.stlbsirthdayparty.com, www.stlsirthdayparty.com, www.stlbyirthdayparty.com, www.stlyirthdayparty.com, www.stlbeirthdayparty.com, www.stleirthdayparty.com, www.stlbdirthdayparty.com, www.stldirthdayparty.com, www.stlbcirthdayparty.com, www.stlcirthdayparty.com, www.stlbrthdayparty.com, www.stlbirrthdayparty.com, www.stlbrrthdayparty.com, www.stlbifrthdayparty.com, www.stlbfrthdayparty.com, www.stlbivrthdayparty.com, www.stlbvrthdayparty.com, www.stlbikrthdayparty.com, www.stlbkrthdayparty.com, www.stlbi,rthdayparty.com, www.stlb,rthdayparty.com, www.stlbibrthdayparty.com, www.stlbbrthdayparty.com, www.stlbigrthdayparty.com, www.stlbgrthdayparty.com, www.stlbitrthdayparty.com, www.stlbtrthdayparty.com, www.stlbiyrthdayparty.com, www.stlbyrthdayparty.com, www.stlbiurthdayparty.com, www.stlburthdayparty.com, www.stlbijrthdayparty.com, www.stlbjrthdayparty.com, www.stlbimrthdayparty.com, www.stlbmrthdayparty.com, www.stlbinrthdayparty.com, www.stlbnrthdayparty.com, www.stlbithdayparty.com, www.stlbirithdayparty.com, www.stlbiithdayparty.com, www.stlbirothdayparty.com, www.stlbiothdayparty.com, www.stlbirlthdayparty.com, www.stlbilthdayparty.com, www.stlbirlthdayparty.com, www.stlbilthdayparty.com, www.stlbir.thdayparty.com, www.stlbi.thdayparty.com, www.stlbirhdayparty.com, www.stlbirtqhdayparty.com, www.stlbirqhdayparty.com, www.stlbirtahdayparty.com, www.stlbirahdayparty.com, www.stlbirt hdayparty.com, www.stlbir hdayparty.com, www.stlbirtwhdayparty.com, www.stlbirwhdayparty.com, www.stlbirtehdayparty.com, www.stlbirehdayparty.com, www.stlbirtzhdayparty.com, www.stlbirzhdayparty.com, www.stlbirtxhdayparty.com, www.stlbirxhdayparty.com, www.stlbirtchdayparty.com, www.stlbirchdayparty.com, www.stlbirtdayparty.com, www.stlbirthedayparty.com, www.stlbirtedayparty.com, www.stlbirthddayparty.com, www.stlbirtddayparty.com, www.stlbirthcdayparty.com, www.stlbirtcdayparty.com, www.stlbirthudayparty.com, www.stlbirtudayparty.com, www.stlbirthjdayparty.com, www.stlbirtjdayparty.com, www.stlbirthdayparty.com, www.stlbirtdayparty.com, www.stlbirthbdayparty.com, www.stlbirtbdayparty.com, www.stlbirthgdayparty.com, www.stlbirtgdayparty.com, www.stlbirthayparty.com, www.stlbirthdtayparty.com, www.stlbirthtayparty.com, www.stlbirthdbayparty.com, www.stlbirthbayparty.com, www.stlbirthdxayparty.com, www.stlbirthxayparty.com, www.stlbirthdsayparty.com, www.stlbirthsayparty.com, www.stlbirthdfayparty.com, www.stlbirthfayparty.com, www.stlbirthdvayparty.com, www.stlbirthvayparty.com, www.stlbirthdyayparty.com, www.stlbirthyayparty.com, www.stlbirthdzayparty.com, www.stlbirthzayparty.com, www.stlbirthdaayparty.com, www.stlbirthaayparty.com, www.stlbirthdeayparty.com, www.stlbirtheayparty.com, www.stlbirthdrayparty.com, www.stlbirthrayparty.com,

    Other websites we recently analyzed

    1. win win lening
      London (United Kingdom) - 89.187.86.129
      Server software: Apache/2.4.7 (Ubuntu)
      Technology: CSS, Html, Php
      Number of meta tags: 3
    2. Carina Verhulst Persoonlijk Leiderschap & Organisatieontwikkeling
      Netherlands - 217.21.241.234
      Server software: squid/3.5.19
      Technology: Html, Php
    3. Myke Walker's Website
      Lake Mary (United States) - 208.94.116.143
      Server software: Apache
      Technology: CSS, Fancybox, Html, Javascript, jQuery Fancybox, Php
      Number of Javascript: 10
      Number of meta tags: 4
    4. Riccione mare.it: i nostri Hotel fronte mare nel centro di Riccione per vacanze e weekend sulla spiaggia
      Riccione Mare è il portale per le Sue vacanze ed i Suoi weekend a Riccione: presenta hotel di Riccione 3 e 4 stelle sul mare e nel centro a Riccione, ed i servizi di ospitalità del Gruppo Atlantic
      Italy - 217.70.144.128
      Server software: Apache/2.2.27 (Unix) mod_ssl/2.2.27 OpenSSL/1.0.1e-fips mod_bwlimited/1.4 PHP/5.4.31
      Technology: CSS, Html, Javascript, Php, Google Analytics, Facebook Box
      Number of Javascript: 1
      Number of meta tags: 3
    5. resideceondablu.es
      France - 94.23.200.8
      Server software: nginx
      Technology: Html
      Number of meta tags: 1
    6. Stile Grafico - Lissone - Monza
      Stile Grafico da oltre 20 anni opera nella provincia di Monza nel settore della comunicazione grafica visiva con professionalità e riconosciuta esperienza.
      Milan (Italy) - 212.48.12.143
      Server software: Apache/2.2.22 (Ubuntu)
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery Cookie, jQuery Fancybox, jQuery UI, Php, SiteCatalyst
      Number of Javascript: 39
      Number of meta tags: 5
    7. karton22.ru
      Russian Federation - 82.146.43.141
      Server software: Apache/2.4.10 (Debian)
      Technology: Html
    8. electricknifesharpenerreviews.com
      Frankfurt (Germany) - 149.126.77.93
      Server software:
      Technology: Html, Iframe, Incapsula, Javascript
      Number of Javascript: 1
      Number of meta tags: 4
    9. injunctionagainstharassment.com
      Scottsdale (United States) - 50.63.202.51
      Server software: Microsoft-IIS/7.5
      Technology: Html, Html5, Iframe
    10. MarketSurf by Stella MORABITO
      Mountain View (United States) - 172.217.22.51
      Server software: GSE
      Technology: CSS, Feedburner, Html, Javascript, Php, Geovisite, Google +1 Button
      Number of Javascript: 7
      Number of meta tags: 2

    Check Other Websites